PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09284A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 612aa    MW: 68686.4 Da    PI: 5.2179
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09284AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.51.5e-08463504144
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                                r +W++ E +l++++ +q+G++ ++ I + ++  +t+ +++ ++
  Oropetium_20150105_09284A 463 RSKWSKSETDLFYQGLRQFGSD-FAMIQQLFP-DKTRHHVRQKF 504
                                789*******************.*********.********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-10455510IPR009057Homeodomain-like
PfamPF159631.5E-25456535No hitNo description
SMARTSM007172.9E-6462510IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-4463505IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MDSEVDFGDI LDAPEEAQPA TKLSLKPRAK PRKTTMQSKS SAPNAALNIR DGDPGAVTQG  60
NSSEELSSVS QDDGRFDDSS KLSTHHESSV VSDIHASTVS SCGKNIDDIV HSGETLDAQA  120
KEETVSKLQK KDSGCHGSGG HASDSEALPR AEPKGKGKSV SFVLPDASDG AAPRQTNSVI  180
DDFDSFFDDL YNMPHKTAQK YSQGEPSDRA VEQQPKSNVG EIGSSMKLRS RKNVQKVGIS  240
QHTVEGYFDE DFVEPSTSEQ DNDNSVNYTA GSKQKIKRNS RDCVEEQEQE GVQNDKGQIS  300
SRGRKKIAKA APTKNTEKKL THRIRQKRMK EVKTLLETPY EMIDHKKLSA AHLRLLQEAR  360
ERNNVSFVAT LVVVPFFKQY FYACPDDFVS SRFYILESVS ILYSYGRLIP SLSVQSSFQH  420
ENPDEFDYSR YNEAENFDED RIETDGTNAT KLNYHSYMKK QTRSKWSKSE TDLFYQGLRQ  480
FGSDFAMIQQ LFPDKTRHHV RQKFKAEEKK NPMLIHDAII HRSGDNLYFK KVIQQLNIED  540
VIPDVSTTCK QDGVSNEGGT TNENASDGFN EEENSSNQLD KEQDVHMSDM QEEEHVRGNS  600
DDDLGDIFDW Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698058.11e-144PREDICTED: uncharacterized protein LOC101786485 isoform X2
TrEMBLA0A0D9UXP41e-125A0A0D9UXP4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009478-PA1e-123(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-25MYB_related family protein